General Information

  • ID:  hor004140
  • Uniprot ID:  P83859
  • Protein name:  QRF-amide
  • Gene name:  QRFP
  • Organism:  Homo sapiens (Human)
  • Family:  RFamide neuropeptide family
  • Source:  Human
  • Expression:  Expressed widely in the brain with highest expression levels in the cerebellum, medulla, pituitary, retina, vestibular nucleus, and white matter. Also expressed in the bladder, colon, coronary artery, parathyroid gland, prostate, testis, and thyroid.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005184 neuropeptide hormone activity; GO:0031854 orexigenic neuropeptide QRFP receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007625 grooming behavior; GO:0007626 locomotory behavior; GO:0045777 positive regulation of blood pressure; GO:0060259 regulation of feeding behavior
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF
  • Length:  43(91-133)
  • Propeptide:  MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR
  • Signal peptide:  MVRPYPLIYFLFLPLGAC
  • Modification:  T1 Pyrrolidone carboxylic acid;T43 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  QRFPR
  • Target Unid:   Q96P65
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83859-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004140_AF2.pdbhor004140_ESM.pdb

Physical Information

Mass: 527123 Formula: C199H303N55O66
Absent amino acids: CHIMVW Common amino acids: G
pI: 4.8 Basic residues: 5
Polar residues: 17 Hydrophobic residues: 12
Hydrophobicity: -71.86 Boman Index: -8060
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 45.58
Instability Index: 2946.74 Extinction Coefficient cystines: 1490
Absorbance 280nm: 35.48

Literature

  • PubMed ID:  12714592
  • Title:  Identification and Characterization of a Novel RF-amide Peptide Ligand for Orphan G-protein-coupled Receptor SP9155